GenomeNet

>bfo:BRAFLDRAFT_130310 hypothetical protein; K00164 2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2] (A)
MYTLRTFWTSGPKLARGVLSQGVPAALRGTPAQPARLLTTSVQQESFLNGSSSNYVEEMY
LAWLDNPKSVHKSWDVFFRNAQRGAAPGEAYQSPPPMAAMMPVQPVAWPMMPLPAAPAVT
SEQISGKVIDDHLAVQAIIRSYQIRGHQCAKLDPLGIMEADLDTSTPRELTLPYYRFSEE
DLDRTFVLPQTTFIGGGNTSLPLRDIIQRLEETYCQTIGLEYMHINDREKCDWIRQKFEI
PGIMSMSNETKRLTLARLVRSTRFEQFLATKYPAEKRFGLEGCEVLIPALKTIIDRCTEQ
GAESFVMGMPHRGRLNVLANVVRKDLDQILCQFDSSLEADDEGSGDVKYHLGCSHMRLNR
TTNKSIKLALVANPSHLEAVDPVVQGKTRAEQYYRGDIEGKKVMSILMHGDAAFAGQGVV
FETFHLSDLPAYTTHGTIHVVVNNQIGFTTDPRFSRSSTYCTDVAKVVEAPIFHVNADDP
EAVAHVCNVAADWRSEFEKDVVIDLVCYRRGGHNEMDEPMFTQPLMYKQIGKQPTVLRQY
AEKLISEGVVTQEEYEEEVSKYDKICEEAYQQAREEKILSIKHWLDSPWTDFFKDKTRDS
MMVCESTGVGEDILTHVGTFMGSPPPDPKFTIHGGVKRILRQRATMVKERWVDWAMAEAM
AFGSLMHSGFHVRLSGQDVERGTFSQRHHVLHDQNRDKVFWTPLDNLWPDQAPYTVCNSS
LSEYAVMGFELGYSMSNPNALVLWEAQFGDFSNTAQCIIDQFISSGQAKWVRQTGITLLL
PHGYEGMGPEHSSARMERFLQMSTEDPDLYPEIDERFEIRQLFDHNWIVANCTTPANYFH
LLRRQVLLPFRKPLVVMTPKSLLRHPEARSSFDDMLPGTTFQRLIPDLGPAGQNHEQVQR
LIFCTGKVYYDLTKERKARDLDDKIAIVRIEQISPFPFDMVKQQCDLYPNADLVWAQEEH
KNMGAWNYIQPRIRTTVNRERHVSYAGRASAAAAATGAKQSHQQELTRLLQHAMNLDNHV
ALWQSQPRRNLTG

BLAST