GenomeNet

>bfo:BRAFLDRAFT_203636 hypothetical protein; K11418 histone deacetylase 11 [EC:3.5.1.98] (A)
SHSTRLHEDIPQSKWPIVYSSDYNIGFLGLEKLHPFDSGKWGKVFRYLKESGLLKDDDVV
TPVEATEEDLLMVHSSGYLNSLKWSMVVAGITEVPPVALLPNFIVQRKLLKPLRLQTGGT
VMAGKLATERGWALNIGGGFHHCSAERGGGFCAYADITLSIKFLFERMEGISKAMIVDLD
AHQGNGHERDFINDSRVYIMDVYNRYIYPHDSYAKGAIRRKVELQAYTEDDRYLSLVRKN
LEKALEEFNPDIIVYNAGTDVLEGDPLGALSISPEGIVQRDQLVFELARGKGRPRQIPIL
MVTSGGYQKRTAQIIADSIKNLIAKGLISHQAAAVETEI

BLAST