GenomeNet

>bfo:BRAFLDRAFT_230530 hypothetical protein; K00128 aldehyde dehydrogenase (NAD+) [EC:1.2.1.3] (A)
MTAIVQHLRENVGKMRSVEYRREQLRALLRCIDENLDRWIEVLRKDLHKVGYAFEYMSLR
TVNELIVHLNNLDEWTKPEYVKKELPQMRDECYIQYEPLGVILVIGAWNYPVQLVLCPLI
AAISAGNCAVVKPSELSEATAALVEDLLPKYLDKAMDCFAVVNGGVKETTELLEQKFDHI
MYTGNSNVGRIVMAAAAKHLTPVTLELGGKSPCYVDKDCDVDVAARRIAWGRFVNCGQTC
IAPDYVLCASQNQDRLLKGIQAALEEYFGKDPRQSEDYCRIVNQRHFHRVKSMIEKTKGS
IALGGDSDEKDLYISPTVVKDVKPTDALMEAEIFGPVLPIVTAESADDAVRFINSRDKPL
ALYAFANDKKVIHDIVQRTSSGSVCGNDTMMQMALPTLPFGGVGTSGMGNYHGKFGFLTF
SHRKAVMVKALAMEKVNSIRYPPYTEKKMSWINWLTNKKEKRRGGLFSFMPFAVIMTILA
VLL

BLAST