GenomeNet

>bfo:BRAFLDRAFT_231117 K11428 histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43] | (RefSeq) hypothetical protein (A)
IEGKGRGVVATKAFGRGDFVVEYAGDLIDTKMAKDREAKYAEDPSTGCYMYYFKYRNKTY
CVDATAESGRLGRLINHSAKHKNLMTRSISAGGLPRLILVAARDIQPGEELQYDYGDRSK
ASLESHPWLAC

BLAST