GenomeNet

>bfo:BRAFLDRAFT_236233 K01186 sialidase-1 [EC:3.2.1.18] | (RefSeq) hypothetical protein (A)
MNYDDETFLPPQVAPIVVEEQLLWLAGTAGVGYYRIPLLSYTPQGSLIAVCEARKEGYAD
FGPKFLAIRRSTDKGLTWGPMDYVLDDGSFYDGISLGAIVVDDETGSVFIMYSHCPHYDH
CTVSTTYLVESTDDGKTWSHPRNISEQVGTMMFAPGPGYGIQKKYEPHVGRLIVCGHSTL
RGDGMFCLLSDDHGQNWRYGGMLRGIPYNQNKKGGDFMPDECQPIELPDGTIEVNIRNEG
GYHCSCRMKVRSFDGGETFPLEHLTFDEALIEPAVAAGLYYNNGVMFFSNPASTNSRSNL
TLRWSYDSGTSWKDALQVWAQPSGYSTMTMLKSDPQDGEYLYMLYEKGRVNQTSYEMLSF
TRISLYGFN

BLAST