GenomeNet

>bfo:BRAFLDRAFT_249134 hypothetical protein; K12357 sialidase-2/3/4 [EC:3.2.1.18] (A)
TFRIPALVHHEGVFLAFCEARKDTYKDWGPMDIVMKRGVLQEGGGVEWSDVQTVCCVPDK
RCMNPTPIVDRTNGTIHLLFGTIPPQVTEHDMIRDGVHQIRLCIVKSKDNGLTWSDPEDL
TDKVLGKENPQWACFAMAPGHGIQLKSGR

BLAST