GenomeNet

>bfo:BRAFLDRAFT_249134 K12357 sialidase-2/3/4 [EC:3.2.1.18] | (RefSeq) hypothetical protein (A)
TFRIPALVHHEGVFLAFCEARKDTYKDWGPMDIVMKRGVLQEGGGVEWSDVQTVCCVPDK
RCMNPTPIVDRTNGTIHLLFGTIPPQVTEHDMIRDGVHQIRLCIVKSKDNGLTWSDPEDL
TDKVLGKENPQWACFAMAPGHGIQLKSGR

BLAST