GenomeNet

>bfo:BRAFLDRAFT_88359 K01312 trypsin [EC:3.4.21.4] | (RefSeq) hypothetical protein (A)
MHFFVLLALVSYAAAEGYEDRIIGGFEATPGSVPWQVSLQRSGSHFCGGTLLNSQWVLSA
AHCLVSGMTVVAGEHDLSRNDGHEQSRGVERIIPHPNYNDNTLDNDIMLIKLSSPVTISS
WVSPASLPDSMVSAGTNVIVTGWGNTGSNYPDKLQKVRVPVISRATCNGANAYAGAVTTN
MFCAGYMDGGKDSCQGDSGGPVTRSGTVYGVVSWGYGCAQPNYPGVYTKVKKYTSWINVY
IN

BLAST