GenomeNet

>bfo:BRAFLDRAFT_88359 hypothetical protein; K01312 trypsin [EC:3.4.21.4] (A)
MHFFVLLALVSYAAAEGYEDRIIGGFEATPGSVPWQVSLQRSGSHFCGGTLLNSQWVLSA
AHCLVSGMTVVAGEHDLSRNDGHEQSRGVERIIPHPNYNDNTLDNDIMLIKLSSPVTISS
WVSPASLPDSMVSAGTNVIVTGWGNTGSNYPDKLQKVRVPVISRATCNGANAYAGAVTTN
MFCAGYMDGGKDSCQGDSGGPVTRSGTVYGVVSWGYGCAQPNYPGVYTKVKKYTSWINVY
IN

BLAST