GenomeNet

>bfo:BRAFLDRAFT_97108 hypothetical protein; K05619 transglutaminase 1 [EC:2.3.2.13] (A)
MGKCVSKNREEKDLQPVNVEPVANARTARSVGNAPGPRRLTLLAENLDQCLQVSDVYFRL
SYNRRAHHTEEYESFQLIVRRGQPFQLSLAFDKPYTEENSQVTLEFHTGDSPKISDGTLA
RVPVDSPLGGTSWGAKVTDKGLKTIDLLVQAPPNAIVGKYSIVVETILDGHKYRTERDPY
SHIYILFNPWCKDDSVYLNDEEELQEYIMNESGIIYVGNKRQVMERPWNYGQFEMPVLDA
SLELLDKAKFPPRARWDPIRLVRVVSKMVNSQDEDGVLVGNWSGEYEDGIRPSAWNGSVE
ILQQYHVRKEPVCYGQCWVFAGVTTSVLRSLGIPSRSVTNFASAHDTDGNLVVDIHYDEE
FTPIDYLNTDSTWNFHVWNEAWMTRPDLPAGYGGWQAFDATPQETSEGHYKCGPASVHAI
KNGHVYYGYDAKFIFAEVNADSISWVCPEDGPMYQVWQQEKGIGVKISTKAVGKDEREDI
TDHYKYSEGTEEERLAVEKAVSHGSRPHTYGERPEKADVEFSINAPKEVIVGHDFTASVT
LRNHSNQERSVSMFLTAHTMYYTGVPVTQFHKEKFVVTLQPNGQMTLHAQIEPAQYMSYL
VDQGAIKLNLLGRVKENKCTFAGQTDFRFSVPKLNIHIPARERPDFPVGEEFVVELSFKN
PLSVKLTNTEFHVEGPGIQKPKLISYRDVRPLEAARTLVTMKPVRPGNRKIIANFQSKQL
HDVQGHLEIQVTEDDVIDE

BLAST