GenomeNet

>bfu:BC1G_03423 hypothetical protein; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MDQVNSGLHQQIPTTYRQLQPQAEQALQHGQPHLHHHTLTSQAGLDLSGLVQDDNNSVYH
PDLRSLQDPNAGHPIAHQYPSPIPFERNNGHPQMHVQNPGIQNTGLQNSIQNNGSPHTPQ
QQHPGPGQFGILTAGPSLHHNPIGRLQQGLPQDLQQDDNLFGTPDETDQKSIGHHSHKIV
PNPPDLAAWREKLFNVNEMITLSEEEYNTYFPHVDNVYSHRSTQKYKRKPFVSHYWDCRL
KGQRYYEIQRVNGNGGNGKGDGVAGPHKHDLARSDEIKKNSILRFLQKREKEDKKTQKTY
HKRASGLALSTVKKHTKENDLKLFGSCFCPFVQRVWIALEAKGIQYQYIEVDPYKKPQSL
LEVNPRGLVPAIRHGDWGCGESTVLMEYIEDLQTGPPLFPQDARAKAHSRLWADHMDRKI
VPTFYALLQSQNYEKQEELTAKLRDEISQIVDVCDPQGPFFLGPTLTYTDVHFAPWILRC
RRVLKHYRDWQDPQPGSRWAIWFDAIENNEFVKATTSADELYIDSYERYAMNRPGTSELA
DAVNGGFNLP

BLAST