GenomeNet

>bfu:BC1G_04254 K11987 prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1] | (RefSeq) hypothetical protein (A)
MEQPHQGGPARRLTLGVPKKSTSGNASSNPQVFEGPDHSVKRAGIVGTLESLGKVISTAN
RPLNTETGDGSYDTKQEQSGLLDDLKALRIKDLETLQMTMKQELGSSNLADDKTMLMEKL
IQLVANLPGTSKTRVKLTEVLVDELWGSLEHPPASMLGDKYNYRQADGSFNNIRFPDIGK
AGTAYARSVTPKIVQPNPKPDPGLIFDTIMSRENGGFKPHPNNISSMLYYIASIIIHDCF
RTSHEDFNISMTSSYLDLSPLYGSNQDEQNNMRTLKDGELKPDCFSEKRLLGFPPGVGCI
LIMFNRFHNYVVKQLATINENGRFTPPKDNLPDDKKQAAWKKYDNDLFQTGRLITCGLYI
NIILLDYLRTIVGLNRVNSTWTLDPRIEMERNSKPGTEAGVGNQCAAEFNLVYRWHSCIS
QRDEKWSEDLYMKIFGKSYKEVTMQELLIGLGKLEAMTPEDPLQRDFAGMKRGTDGKLND
DDLVNELTASIEDLAGSSGANNVPAVLRAVEILGMEQARAWKCATLNEFRKHFGLIPHEK
FSDINSDPAVYEKLKVLFDEPDLVELYAGLVCEDAKKPMDPGVGIGPTYTISRSILSDAV
TLVRGDRFYTTDYHPANLTNWGVTEVKYDLNVNQGCVFYKLFIRAFPNHFSYNSIYAHYP
LTIPSENKKIMEKLGRADDYSWDKPVKVPERKNIVTFDGVKSVLTNAEVFGVDNWRRGLA
YLMGKPGANFMLAGDGDFFAERRNQMKECLYQDKWHESVKNYYESIVPRLLKRWSYNIGG
TTNQVDVIRDIDNSAHVHFAANVFHLPLKTEENPKGVYTEHELYMVLAVIFIVIFFGDVD
PAKTFSLRAAGLPVTQDLGQLVEQNVNFISKTSLVSGIVDTFMEENNALKDYGVHMVRHL
LKAGLGVHETVWSQILPTAGAMVANQAQVFGQVLDFYLGDGKEHLPEINRLAKLNTAEAD
DILLHYLLEGIRMYGTFGAYRTCHQNITINDGSRKVECKPGDSVFVSFVSLAQDPKIYPD
PKTVRLDRPVDSYLVYGVGSHACLGGEASRVALTAMLKCIGRLDNLRRASGPQGEMKKVP
REGGFYVYMDKMMGSEFPFPTTMKICWDGGLNEPVPVVEKGKGKKNGA

BLAST