GenomeNet

>bfu:BC1G_05277 K00006 glycerol-3-phosphate dehydrogenase (NAD+) [EC:1.1.1.8] | (RefSeq) hypothetical protein (A)
MSASNQTLRRIAQTAGHLSTPQSNKMATLGAWSKKHKVTVVGSGNWGCTIAKIVAENTKQ
HSDLFEEEVQMWVYEEEVTIPKDSKHYDASNDSPQKLTSIINKYHENVKYLPNIQLPTNL
IANPSVEDAVANSSILIFNLPHQFIGRITKQLQGHILPFARGISCIKGVNVTASEISLFS
EWIGEGLGIYCGALSGANIANEIAMEKWCETTIAYDPPSMDSRATTPTGPSPSSSQVNLT
ITPADEEHKDVKGRVSKTKLKAVPSEYPPMDHALFKTLFHRPYFHVQMVSDVAGVSLGGA
LKNIVALAAGFVEGRGWGDNAKAAVMRVGLLEMVKFGKEFFGETVHGGTFTEQSAGVADL
ITSCSGGRNFRCAKMAIERGVTVDEVEKTELNGQKLQGTSTAKEVNEFLKSRGKEGEYPL
FTAVIDILEGRNTVDDIPDLLAKSDE

BLAST