GenomeNet

>bfu:BC1G_06362 K00128 aldehyde dehydrogenase (NAD+) [EC:1.2.1.3] | (RefSeq) hypothetical protein (A)
MTSVQLKTPLTGEYTQPTGLFINNEWVKGVDGKTFEVINPTTEEVITSVHEATEKDVDIA
VAAARKAYEGEWRHVTPEGRGKLLVKLAELVEKNADLLAAVESLDNGKAISMAKGDVAAV
AGCLRYYGGWADKIEGKVIDTDPEYFTYTKQEPIGVCGQIIPWNFPLLMWSWKIGPAVAT
GNTVVLKTAEQTPLSALVAANLIKEAGFPPGVVNIISGFGKIAGAAIASHMDVDKVAFTG
STVVGRQIMKAAAGSNLKKVTLELGGKSPNIVFNDADIENAISWVNFGIFFNHGQTCCAG
SRVYVQDGIYDKFVESFKARAIANKVGDPFHHETFQGPQVSQLQYDRIMGYIDEGKKSGA
TVVTGGERHGDKGYFIQPTIFSDVTEDMKIMQEEIFGPVCSIAKFSTEEEIIKIGNGSNY
GLASAVHTQNLNTALRVSNALKAGTVWVNCYNMLHHQVPFGGYKESGIGRELGEAALSNY
TQTKSVRIRLGDALFG

BLAST