GenomeNet

>bfu:BC1G_06927 hypothetical protein; K01580 glutamate decarboxylase [EC:4.1.1.15] (A)
MSSNLTEAALPLRDDTVSTGPDAPNPLNRADEVEDLLNAVQSLIIPFIRSADEDATTKHT
GHGKAIPGGGPRTTLLEHHKPEKLLQLLDFNLPINGRGKNANTLPADYLFHTIEDGAEVW
DLADLTLQCGRRGDSLKLALSWIYYGTSGFQQQIDHAFSVAGYFAQLVNEHKDFVLVSEN
PPPCLQVCFYYAKDGKLGGKEQNTKITQDVAQKLLTRGFMVDYASGEKGKFFRAVVNVQT
RRETMEGLVKAIVEIGEGVVV

BLAST