GenomeNet

>bfu:BC1G_10553 K11483 histone deacetylase HOS2 [EC:3.5.1.98] | (RefSeq) hypothetical protein (A)
MSSIVQEWGVPLQEPNDTDNLRYLEEVKKEVIKNGIVRPTGYNVSFHMNPMIEKHHFGPK
HPMKPWRLTLSKGLIMAYGMHVAMDTYVSRAATQDELEDFHTHDYLEYLKSAKVGPPDER
IETPYNLGSFDCPVFDGLFNYCSMYSGASIDAARNLSNGTSDIAINWSGGLHHAKKTEAS
GFCYVNDIVLAILQLLRKVPRVLYIDIDVHHGDGVEEAFWSTGRVMTVSFHKWDPVNFFP
GTGALDDTGPKNENNQGAHHAVNVPLNDGIDDEQYIRVFKQVIDKCVEKFRPSAIVLQCG
ADSLAGDRIGTFNVLVQGHGACVEHVKGYGIPLMLVGGGGYTPRNVARAWTNETSIAIGA
KLNEELPMHTPYREHFRNQSLYPDLTELLSAKGSVPKGQTGARKNHNSEKKINDIVSSIH
EQLRFVEHAPSVQSQDLPPDLGAWKQDVEDEIKEAKEQEESYRLQREEGLGILREYA

BLAST