GenomeNet

>bfu:BC1G_12178 hypothetical protein; K00844 hexokinase [EC:2.7.1.1] (A)
MSLLAEAKRVAAEFEYTDEDVRRGVAEFVAEMNEGLEKNATNMSQIPTYVTGVPNGTEKG
LYLAVDLGGTNFRVCSIQLHGDTTFSLTQSKVAIPRELMLAKTASDLFSFLAKQIELFLK
THHEDHFAAHIRRRNTVSTPEGFRDEHIFRLGFTFSFPVHQIGINRGTLIRWTKGFDIAD
AVGQDVCDLLQKEIDKLHLPVKVAALVNDTVGTLMARAYTSPGKTQTLLGAIFGTGTNGA
YVEKLEKLTKPMEGDFDKTTGEMVVNTEWGSFDNGLKVLPNTIYDQILDKDSVNPGIQMF
EKRVSGMFLGEILRTVLVQMIKSPTIPLFRDTSSADNDYRSTTTVDENGPLFKQWAVDSS
ILSIAEADNSVGLRALRQELEKSLGVSAASLEDAQTVKDIAHAIGKRAARLAAVAIGAIV
LQTGRLDIKSDTPGPKSAAAIIQDVKDLKIADAASATANKLADTAGLAVNEEDVVDIGVD
GSLVEFYPGFEDHMREALRAMDGIGAIGERRIRIGIAKDGSGVGAALIALVAAKMEKQQD
YIGDLRSRYGVTGENVLGE

BLAST