GenomeNet

>bgb:KK9_0151 sodA; SodA protein; K04564 superoxide dismutase, Fe-Mn family [EC:1.15.1.1] (A)
MFKLPELGYNYDAVEPYIDAKTMEIHHSKHHNGFVMNLNSIFEKMGKSHLKDVSSILKNI
HDFPDEFQTPIRNNAGGYSNHTLYFRSLKPGNKSNLLEKFENDVNRAFGSLDVLRASLKD
TAMKIFGSGWAWLVLCPDSGLKVISMPNQDSPLMKSYKPILGIDVWEHAYYLKYQNRRIE
YVDAFLKALNWEEVSKIYNEANN

BLAST