GenomeNet

>bgd:bgla_2g23500 glutathione S-transferase domain-containing protein; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MAARVPGRRLAVSQGAAPFLFYADWTHRIDRGFRHVIAYRERLLARPSFARAVDEARPYR
KLFPLGAPEAD

BLAST