GenomeNet

>bgf:BC1003_1569 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) DNA ligase D (A)
MNDRLDLYNRKRRFDETPEPAGTRPAKKRGGRGAAHPEAAEGLSYVIQEHHARRLHYDFR
LELNGALLSWAVPKGPCLDPSVKRLAVHVEDHPVEYGSFEGEIPPGNYGAGTVIVWDRGT
WEPLGGPAEAARAYRAGKLKFHLHGEKLHGGWTLVRSHMRGNADKEQWLLIKEPDDEARD
ESEYDILAERPGSVLGGESAPAKAKGKAKGGSRAATGKSQMASVRGDPKRPDIVATRSNE
SLRELAASPAIEGAVKARLPAALKPQLATLVDATPPGDDWAYEIKFDGYRVLARIDASAK
GHGVQVFTRAGNDWTARFSRQVKAFGQLGLESAWLDGEAVVLDENGVPSFQALQNAFDSN
RPQDIVVYLFDVPFLNGYDLRGVPLQQRRAILRALLEPVDDSVLRFSNDFEFSADDLLKS
ACDMALEGIIGKRRDSGYVSGRSATWIKLKCRRRQEFVIGGYSEPSGSRAAFGALLLGVH
DSKGKLQYAGRVGTGFDAALLRSVKKELDAHETKRMPFASPPRERSRTPVHWVEPVLVAE
CNFAEWTSDGIVRQASFVSLRKDKPARQIVKEAPRKGDDVQQQTDIEADTAPKKRAARSK
GTGKTAAATADELAEGTAEKNARKPVEPAAKSAAKPAAKAAAKSGASAKRTATSDTDNDT
ENDTHAQSPASRSRKSASPAEVAGVRISHPDRVIDKSTGARKIDLVQYYESVARWMLPHL
ADRPVSLVRAPEDIGGELFFQKHTQKLSIPNITQHPGLDPGHPPLITVDSVKALVGAAQM
GTIEFHTWNGVASNIEKPDRVVFDLDPDPSLGWERMIEAALLTRTLLEELGLTSFCKTSG
GKGLHVVVPLAKHAGWDEVKGFSQAVAQHMASTLPKYFSAKMGAQNRKQKIFVDYLRNNR
GSSTVAAFSVRARPGLGVSVPLAWDEVAQTTGGDQWNIRNLHERLAQLKSDPWAEYPKTR
QRITAAMRKRLSGA

BLAST