GenomeNet

>bgl:bglu_1g00950 aldehyde dehydrogenase family protein; K00128 aldehyde dehydrogenase (NAD+) [EC:1.2.1.3] (A)
MNHAEMQHLNIEFPYRKQYGNFIGGKWVPPVGGDYFDNVSPVTGKPFTSIPRSQAADIEL
ALDAAHAARAAWGATPAADRAGILLKIADRMEANLARLAVAETIDNGKPLRETTAADIPL
AIDHFRYFAGCVRAQEGSIADIGGDLVAYHFHEPLGVVGQIIPWNFPILMATWKLAPALA
AGNCVVLKPAEQTPASILVWAELIQDLLPPGVLNIVNGFGLEAGKPLASSKRIAKVAFTG
ETSTGRLIAGYASANLIPVTLELGGKSPNIFFADVMDRDDSYFDKALEGFAMFALNQGEV
CTCPSRALVEESIYERFIERAVQRVEKIRQGHPLDAQTMIGAQASEEQMEKILSYIEIGR
QEGAECLTGGARNTMTGELASGFYVKPTVFRGHNKMRIFQEEIFGPVLSVTTFKNEAEAL
EIANDTPYGLGAGLWTRDGNRAYHFGRNIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRET
HKMMLDHYQQTKNLLVSYSDKPAGLF

BLAST