GenomeNet

>bgl:bglu_1g00950 K00138 aldehyde dehydrogenase [EC:1.2.1.-] | (GenBank) Aldehyde dehydrogenase family protein (A)
MNHAEMQHLNIEFPYRKQYGNFIGGKWVPPVGGDYFDNVSPVTGKPFTSIPRSQAADIEL
ALDAAHAARAAWGATPAADRAGILLKIADRMEANLARLAVAETIDNGKPLRETTAADIPL
AIDHFRYFAGCVRAQEGSIADIGGDLVAYHFHEPLGVVGQIIPWNFPILMATWKLAPALA
AGNCVVLKPAEQTPASILVWAELIQDLLPPGVLNIVNGFGLEAGKPLASSKRIAKVAFTG
ETSTGRLIAGYASANLIPVTLELGGKSPNIFFADVMDRDDSYFDKALEGFAMFALNQGEV
CTCPSRALVEESIYERFIERAVQRVEKIRQGHPLDAQTMIGAQASEEQMEKILSYIEIGR
QEGAECLTGGARNTMTGELASGFYVKPTVFRGHNKMRIFQEEIFGPVLSVTTFKNEAEAL
EIANDTPYGLGAGLWTRDGNRAYHFGRNIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRET
HKMMLDHYQQTKNLLVSYSDKPAGLF

BLAST