GenomeNet

>bha:BH1509 methyl-accepting chemotaxis protein; K03406 methyl-accepting chemotaxis protein (A)
MDQHVEAVMERNRLLVKLIWFMFALGLVSNFVSRVPQEGIIAYVITGVVLGLAITFLTFS
GKVPLFIPYMVTVCYGILTFVIGMTSPKLSNYLLVFISLAIVALYHQFRVIALSGVIGLL
LTNYFFLTLRDSMFIGLDEQVLFSLNLYVLLLTVILMAQAKIGEQMRAKVEADHALVVEE
KKRTEQLLDRVAETSHVIETFSEKVLSEMEKTKDVSQELVGAFNEVSQGVEQQSGNITEM
KETMLKQDQAVSQMAEVSESTKKLAKQGKEKSEESYTNMLGWSKEVTELQATVDETLTTI
LGLSKKSQQITSIVATVNQIAEQTNLLALNAAIEAARAGEQGKGFSVVAEEVRKLAQDSQ
AATQQVNAILGDIQKMTGAISEKMMNSKTVTDKGVERATGMLESLTISEQMMSSIASDCE
LLDDRLSLLSKSQMSLTEEIVSVQSVTQQSQAMVEEVFASVEQQNQAIQNVTKQLEELNQ
LNGRLVAALSQTENISPDEK

BLAST