GenomeNet

>bha:BH2209 BH2209; unknown conserved protein; K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] (A)
MKPMLLQTTTDLPTGDNWRYEVKYDGFRTILFWTKETIRLESRNERLLTDQFPEIHDFCQ
RISNKVEAWLPITIDGELVHLVSPYRAHFAPIQTRSFMRKHETIAASSIKTPATLLAFDI
LELKGKTLVDLPYDERKKQLKALLKAIDVPLEPTIQSNACLQMIPAQTDGQALWQAVELH
HGEGVVAKDRFSDWTEGKRTNRWLKKKNFRQVTVFLTAYDPVNGYFHFAVYRDGTSVEVG
NVTHGFEDHERETLIAFMKQNGMKKGKRYVLEPSVCFDVDCIDFDGKHLREPMFHRFRLD
VKPAQCTWKSLQRQLAPLPPQVEITHPDKPLWPRQMIQKIDYLYYLQEVAPAMLPFLIDR
PLTVIRYPHGVRSNTEREAFYQKNCPDYAPSFVKTVRLDEIRYIVCNDIQTLVWLGNQLA
LEFHIPYHPVPYTKPSEIVFDLDPPSISQFSLAVKAAQLMKNMFDALKLQSFVKTSGGKG
LQLYLPLPDNTFTYDDTRLFSKTVCELLCSQFPEDFTTERLKKHRGQRLYLDYLQHDEGK
TIVAPFSPRGNEGGFIATPLRWEEVTNTLSPDQFPMKAVLERYRNGIQPFATFAEAKKTQ
PFADVLKKFKR

BLAST