GenomeNet

>bhy:BHWA1_01863 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) thymidine kinase (A)
MFAGKSKYLIKTLDYLLLENKNIKILFIYPAISFRGYFCRDKNVYLDKRIDIITEEEIEN
NIGKDVENIYNYIARYDIVGIDEFCFLNDTSIFIQLIKTCTQRNCKTNFCIASLDMDYKR
NYWESVSALIEEDLIDIHTKVFGKCDCGRKGIYSKRIVKDVDRVVIGDDIYKCVCRYCYE
GEDEVKFNL

BLAST