GenomeNet

>bhy:BHWA1_01863 thymidine kinase; K00857 thymidine kinase [EC:2.7.1.21] (A)
MFAGKSKYLIKTLDYLLLENKNIKILFIYPAISFRGYFCRDKNVYLDKRIDIITEEEIEN
NIGKDVENIYNYIARYDIVGIDEFCFLNDTSIFIQLIKTCTQRNCKTNFCIASLDMDYKR
NYWESVSALIEEDLIDIHTKVFGKCDCGRKGIYSKRIVKDVDRVVIGDDIYKCVCRYCYE
GEDEVKFNL

BLAST