GenomeNet

>bja:blr2586 cbbS; ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit; K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] (A)
MKLTQGCFSFLPDLTDDQIYKQVQYCLAKGWAVNIEFTDDPHPRNTYWEMWGLPMFDLQD
AAGVMMELAECRRVYGDRYIRISGFDSSPGWESVRISFLVNRPPQEAEFELVRQEVGGRA
IRYTTVRKAPAHVS

BLAST