GenomeNet

>bjs:MY9_3135 transglutaminase; K00686 protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13] (A)
MIIVSGQLLRPQDIENWQIDQNLNPLLKEMIETPVQFDYHSIAELMFELKLRMNIVAAAK
TLHKSGAKFATFLKTYGNTAYWRVSPEGALELKYRMPPSKAIRDIAENGPFYAFECATAI
VVIYYLALIDTIGEDKFDASFDRIILYDWHYEKLPIYTETGHHFFLGDCLYFKNPEFDPQ
KAQWRGENVILLGEDKYFAHGLGILNGQQIIDKLNSFRRRGALQSAYLLSQATRLDVPSL
FRIVR

BLAST