GenomeNet

>bju:BJ6T_19970 hypothetical protein (A)
MSRTSTLPKRLQPMLATLTDAPFDDPDWVFEDKYDGFRMIAEIRRGKVALYSRNGKIISR
SYIEVAKALEGVKGDAVIDGELVAIGKDGISHFQLLQNALRHEAKLLYCAFDLMFENAVD
LRGEPLLERKKRLKAILPRNKLIAFSAHRKGNGTKFFTEAERKGLEGIMAKRADSSYASG
SRTSDWLKIKTAKRQEVVIAGFTAPKRTRPFFGALVLAVREDDAWRYIGHVGTGFSHKAL
EDLHAKLLKLRASKSPFPAKVKDEAATTWVRPSLVAEVKFAEWTGNGELRQPVYLGLRSD
KRAKDVVRERERLRK

BLAST