GenomeNet

>bju:BJ6T_22360 hypothetical glutathione S-transferase like protein; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MDLYFSPLACSMATRVALYEAGAEANYLEVDPPTKKVLNDGTDFRTINPIGLVPTLRTDE
GVVLTENAAILQYVADRFPQSGLGAAAGIDRTRLHQWLCFIGTELHKGLFIPLLDRKAPQ
ETKAYALEKNLSRLDYLDNYLKGRDFLLDHFSVADAYLVTVINWTMATPPIELAKWPNVK
AYHDRLRQRPSVAKAIAEEFELYKAEQARKKAAA

BLAST