GenomeNet

>bju:BJ6T_31410 no KO assigned | (GenBank) hypothetical protein (A)
MQLMEAESVAQLPRGAQWQYEPKWDGFRCLLIRERSRVSMQSKSGRDLVRYFPEIAAAAA
ALSPKTLTLDGELIIELDEGYSFDALLQRIHPAASRVKHLAKETPATFMVFDLLRSGARD
LSGLPLMKRRAALETLAGKAFQASGLFRLTPASRNYADAEAWLNSVNEDHDGVVAKRLDL
PYRGGTRDGMQKIKLLRSADCVVGGFRYAERKQGNRKVVGSLLLGLYDKGGLLHHVGFTS
GIRSSDRLALTDRLEKIVGLQSFTGNSPGGPSRWSTKRSAEWKAVRPTFVVEVSYDHVTG
DRFRHGTKVIRWRPDKKPSQCRMDQLRQRAATQTFRAAT

BLAST