GenomeNet

>bju:BJ6T_39060 hypothetical protein; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MKYELYYWPEIQGRGEYVRLALEEAGAAYVDVARGARGTSAMMKMMDAHEGTPPFAPPFL
KAGKLVIGQTANILLYLGARHGLAPKTEAGKLWVHQLQLTITDLVVEIHDTHHPLGPSMY
YEDQKAPAKKRTAEFWDERVPKYLGYFEEILVGNGGVYVTGRRLTYVDLSLFQIVAGLRY
AFPKRMKAFEGNIPGLVDLHDRIAARPNIKTYLASARRIPFNEQGIFRRYRELDG

BLAST