GenomeNet

>bju:BJ6T_64220 K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] | (GenBank) hypothetical protein (A)
MTLSWPLDNIGASLPNLVTAIAGNLWELRQLTGLRLLDLRLPLAFAAAYPGPKFGVAGTR
ELTGVSGRPLIGTIIKPSIGLSPAETASLVATLCAAGIDFIKDDELQSDGAYCPFDARVR
AVMRVVNDHADRTGKKVMIAFNLTGEIDQMRRRHDLVLSAGGTCVMASINSVGLTGMVEL
GRHTQLPVHAHRNGWGALNRHPALGWDYTAWHKIWRLAGADHMHVNGIGNKFSETDDSVV
VSAKAALTPMFAHKPCIAMPVFSSGQTPAQALPTWRALGSTDLIFAAGGGILAHPDGPAA
GVADLRAAWDAAMASPQP

BLAST