GenomeNet

>bju:BJ6T_73170 hypothetical glutathione S-transferase like protein; K11209 GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-] (A)
MLKFYFNGSPNPTKVALFLEEAGLAFEPVKIDTRTGDQFAPDYLKINPNGKVPAIDDNGT
IVFDSNAILLYLAEKTGKFLPAANVRGETLSWLMFIATGVGPYSGQAVHFKHFAPKDQNH
DYAHNRYQYETDRHYKVLDAHLKGRSYMVGDSYSIVDMALWGWARMVPFKLGDDAFARYP
NVKRLVDEISARPAAARAIALKDKFTFKAEMDDEARANMFKHMTTKVA

BLAST