GenomeNet

>blb:BBMN68_1257 hypothetical protein; K01176 alpha-amylase [EC:3.2.1.1] (A)
MDSDKAAVWVTNWDTERNGSSLTTRDGTSYLLANAFMLAYDYGQPHIFSGYYYAGVDDGA
PGATRTSVPDMTCPTDGIETAGTWHCAQRWTAIRGMIGFRNAVAGTFTATVAKGSAVALY
AGATPANWAGTRKYDPSDPAWFTGETPHKGDDTAAKSADSAASAKSGDAKSGKATSDAIR
RAATLAAILLPVIVGVTFMAIARRNGKAQSDNSGPNND

BLAST