GenomeNet

>blb:BBMN68_1257 K01176 alpha-amylase [EC:3.2.1.1] | (GenBank) Hypothetical protein (A)
MDSDKAAVWVTNWDTERNGSSLTTRDGTSYLLANAFMLAYDYGQPHIFSGYYYAGVDDGA
PGATRTSVPDMTCPTDGIETAGTWHCAQRWTAIRGMIGFRNAVAGTFTATVAKGSAVALY
AGATPANWAGTRKYDPSDPAWFTGETPHKGDDTAAKSADSAASAKSGDAKSGKATSDAIR
RAATLAAILLPVIVGVTFMAIARRNGKAQSDNSGPNND

BLAST