GenomeNet

>bld:BLi01494 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) ykoU; ATP-dependent DNA ligase YkoU (A)
MGITMQPVLTTSAPSGGNWRYEVKYDGYRGLLKIAATGEVSLISRNSQPLENTFPEISEF
AKSMIETLKEHLPITIDGEIVSLTNRFRSRFEYVQKRGLSKKAELIAQAAAKKPCQYLAF
DLLVFNGESLTSLPYTERKRMLFDLMKELGLPMAPDPMAHARIQYIPDTSDFHDLWKAVK
RFDGEGIVAKKKDSRWAENKKTAEWLKLKNYKKAAVFMTGYNMANRYLTIAVYDRGQIKE
VGSVSHGLGEQERNAILSIVKQYGTETKPGEYTIDPSICMTVHYLTIHYGTLREVSFVSF
EFDMAWENCTYNRLLLHSRNVHPDLQLTSLDKVIFPKSDKTKADYIGYLNEIGDFLLPFL
DNRALTVIRYPHGSGGESFFQKNKPDYAPEFITSIRDDEHEHIICSDYSVLLWLANQLAL
EFHIPFQTVDTAHPTEIVFDLDPPSKSEFPLAVRAAKELHRLFDQLGLLSFPKLSGNKGI
QIYIPISKNAFTYEETRLFTSFAASYCVSLFPDLFTTERLIKNRGGKLYIDYVQHAPGKT
IICPYSTRGNELGTVAAPLFWDEVHSDLSPLNFTMEAVVKRTKELGCPFESFFRQPQDKQ
IKAILDHLKENNRSEN

BLAST