GenomeNet

>bld:BLi03298 K00686 protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13] | (GenBank) tgl; protein-glutamine gamma-glutamyltransferase Tgl (EC:2.3.2.13) (A)
MISVSGYRLRPEDIEKLNVSQTQRDIANRMLAMPSGYRYGSISELLFELRFREHTVKSAR
ELINSGAKFATFSKTYGNEEFWRVTPEGALELKYRAPASKAIRNIFESGPSYAFECATAI
VIIFYMALLKTIGDQTFDRNYQRIILYDWHYERLPIYTDKGNDYLPGDCLYFKNPEFDPS
RPQWRGENAILLENNLYAAHGLGILSGETIIEKLNGLRKPHAQTSAYLLSQVTRVDIPAL
IQMIR

BLAST