GenomeNet

>blh:BaLi_c33790 tgl; protein-glutamine gamma-glutamyltransferase (EC:2.3.2.13); K00686 protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13] (A)
MISVSGYWLRPEDIEKLNVSQTQRDIANRMLAMPSRYRYGSISELLFELRFRVHTVESAR
ELINSGAKFATFSKTYGNEEFWRVTPEGALELKYRAPASKAIRNIFESGSLYAFECATAI
VIIFYMALLKTIGDQTFDRNYQRIILYDWHYERLPIYTDKGNDYLPGDCLYFKNPEFDPE
RPQWRGENAILLENNLYAAHGLGILSGETIIEKLNGLRKPHAQTSAYLLSQVTRVDIPAL
IQMIR

BLAST