GenomeNet

>bln:Blon_1092 bifunctional HTH-domain containing protein/aminotransferase; K14260 alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2] (A)
MNSRGLKQVDLVHAAEHRGVKMGKSHISQYVAGKTMPREDVLEFLASELDVDANWLRGEE
SSAPSNGDAAPEGAGPRTDDGTAPARRRTFGKSHKLDNVLYDVRGPVADEAMRMEANGTH
ILKLNIGNPAPFGFRTPDEVVYDMAHQLTDTEGYSPSKGLFSARKAIMQYAQLKNIPNVT
IDDIYTGNGVSELINLSMSALLDTGDEVLVPSPDYPLWTACVNLAGGTAVHYLCDEQSEW
YPDIDDIRSKITSNTKAIVIINPNNPTGALYPKEVLQQIVDIARERRLIIFSDEIYDRLV
MDGLQHVSIASMAPDLFCVTFSGLSKSHMIAGYRIGWMILSGNKRIAKDYIEGLNMLANM
RMCSNVPAQSVVQTALGGHQSVKDYLVPGGRVYDQRDLVYDMLNAIPGISAVKPKAAFYI
FPKIDVKRFNIHSDEQFALDLLHEKHILISHGGAFNWRHPDHFRVVYLPRIGMLHETMEE
LADFFSYYRQN

BLAST