GenomeNet

>bmd:BMD_3612 K00001 alcohol dehydrogenase [EC:1.1.1.1] | (GenBank) alcohol dehydrogenase, zinc-containing protein (A)
MRAMVIDRYGKVPMHLAEMPTPEIGEYEVLAEIHAASINPIDFKIRDGKVKLLVKYKMPL
ILGNDFSGVVAKVGAKVTRFKAGDEIYARPRKSKIGTFAEYIAIHEDDIALKPKNLNFEE
AASIPLVGLTSYQALTDILQLKKGQRILIQAGAGGVGTFAIQLAKLMGATVATTASEAGA
NLVKSLGADEIINYKTEKFEEILKNYDAVFDTLGGEILEKSFGIIKDGGKLVSVSGLPNA
RFGKEYGSGFFKTLLFSAASHKLTGLEKKHNVQYTFLFMKPSGEQLRIIANFIETGKIKP
IIDKVFSFKDAQKAMEYAESGRAKGKIILKIR

BLAST