GenomeNet

>bmf:BAB1_0482 K00645 [acyl-carrier-protein] S-malonyltransferase [EC:2.3.1.39] | (GenBank) fabD; Acyl transferase domain:Malonyl CoA-acyl carrier protein transacylase (A)
MAVAFTFPGQGSQAVGMGKALAEQFAEARAVFDEVDEALGEKLSATMFEGPEDVLTLTAN
AQPALMAVSMAVQRIMEARGFSLKDKVSYVAGHSLGEYSALCAAGTFSLADTARLLRIRG
NAMQKAVPVGEGAMAAIIGLEHGDVEAVCMEAKASGPVQIANDNGGGQLVISGARAAVEL
AAKLGSEKGAKRAIMLPVSAPFHSTLMAPAADAMLEALAAVEKHDPVVPLIANVRAAPVT
DANEIAALLVEQVTGQVRWRETIEWFSANGVTTLYEVGCGKVLTGLARRISKDVSGAAVG
SAEEIEAALAALNA

BLAST