GenomeNet

>bmf:BAB2_0865 Bacterial extracellular solute-binding protein, family 3:Pyridoxal-dependent decarboxylase (EC:4.1.1.15); K01580 glutamate decarboxylase [EC:4.1.1.15] (A)
MCWHKFARYWDVEIREIPMEPGRLFMGPEQMLEAVDENTIGVVPTFGVTYTGNYEFPEPL
QDALDKLQKTKGLDIDIHVDAASGGFLAPFCAPDIPWDFRLPRVKSISASGHKYGLAPLG
CGWVVWRDKEALPEELIFNVDYLGGQVGTFAINFSRPAGQVISQYYEFMRLGREGYTKVQ
QAAYRVAQYIAREIEPLGPYEFICAGEEKGGIPAVCFRIREGEDPGYSLYDLSERLRLTG
WQVPAFALSGKASDITVMRVMCRCGFEMDLAALFIRDFKAGIEFFKSHPSPKITPSMGTG
FHHT

BLAST