GenomeNet

>bmg:BM590_A1491 Protein gstA; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MLTIYSQPDSGNCYKPRLLLAKLGKPFRHVTVSALDGSTRTPEYLARNPNGKVPLLELED
GRFLAESNAILLYLAEGTRFLPVDPYERALVYQWLFFEQYSHEPYIAVRRALKIYPERAG
DATPERLAATLAGGEKALSVMDVQLRKTPFIAGDHYTVADIALYAYTHEAHLGGFDMQKY
RAVGDWLERVAADKGHVPIDWLP

BLAST