GenomeNet

>bmg:BM590_B0977 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) Glutathione S-transferase, N-terminal protein (A)
MKLYYKAGACSLASHIILEEAGLAYTLEAVDLKAKKTASGADYLAINPRGAVPALEVEPG
VVITQNAAILQYIGDHSHVAAFKPAYGSLERARLQEALGFCSDLHGAFGGLFAPNLSEEA
RPGIIANINRRLGQLEAMLADEHSYWLGAEFTQADAYAAVILGWGVGMKLDLNAYPKALR
LYERVLARPNVQKAMKEEGLI

BLAST