GenomeNet

>bmh:BMWSH_0036 K01176 alpha-amylase [EC:3.2.1.1] | (GenBank) Alpha amylase catalytic region (A)
MERNHTIMQFFEWHVPADGEHWQRLKELAPQLKEQGIDSVWIPPVTKGVSSEDNGYGVYD
LYDLGEFDQKGTVRTKYGTKQELHEAIDACHNHGINVYVDIVMNHKAAADEKETFHVIEV
DPMNRTEEISEPFEIEGWTKFTFEGRGDQYSSFKWNFNHFNGTDYDDKNGKEGVFRIAGE
NKSWNENVDQEFGNYDYLMFANIDYDHPEVREEMIKWGKWLADTLQCDGYRLDAIKHINH
DFIKEFAHELSSSQEKPFYFVGEFWNPELTACQEFLDVIDYQIDLFDVSLHYKLHEASQQ
GRDFDLTTIFDDTLVKTHPLNVVTFVDNHDSQPNESLESWVEDWFKQSAYALILLREDGY
PCVFYGDYFGIGGEHPIEGKEKDISALLHVRYDKAYGQQDDYFDHPNTIGWVRHGVEEFE
KSGCAVVMSNGEDGEKRMFVGEHRSGQTWIDFTNNREDQVVIEEDGYGQFPVNGGSVSVW
AEA

BLAST