GenomeNet

>bmh:BMWSH_0324 K04565 superoxide dismutase, Cu-Zn family [EC:1.15.1.1] | (GenBank) sodC; Superoxide dismutase copper/zinc binding protein (A)
MRLEGNMKKLLLIGTVPFFLLTGCMEKEISNKEVKVYNADGDSIGTVKLKEQADGIEFTY
NLSGLPPGEHGVHIHEMGICKAPNFKSAGNHLDPDKKKHGLLNPKGPHLGDMKNIVVEDD
QTYTGTDMVPQVTLKEGKTSLVKRMDGSSLVITEQGDDGMTEPSGNSGKRIACGVISKKH

BLAST