GenomeNet

>bmh:BMWSH_2770 tgl; transglutaminase (Protein-glutamine gamma-glutamyltransferase); K00686 protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13] (A)
MIKVNQQIVKISDLNNSSLTKEKADILKQMDAYREVYEYATFDHLDFDVSVKLQIIESSV
LLRKSGARFATFARSRCNEKYWKRTDDGGFQLLPTVSPHQAIDDIFYNGHEYAFECATAV
IIIFYKAVLNNIGKANFNRLFADLYLHDWQYDEDLELHGYKGSDYLPGDCAYFKNPDYNP
DTPQWKGENTIVLDETLYFGHGIGITTRERIIEVLNLKRKDDPKRSAYLSDEIVRLQTAH
LSYFAVRYEPVVWYDRNSAIISTIGSITYVA

BLAST