GenomeNet

>bmj:BMULJ_00438 K00931 glutamate 5-kinase [EC:2.7.2.11] | (GenBank) proB; glutamate 5-kinase (A)
MRSIIADSKRLVVKVGSSLVTNDGKGLDHAAIGRWAAQIAALRAQGKEVVLVSSGAIAEG
MQRLGWSKRPREIDELQAAAAVGQMGLAQVYESRFTEHGIRTAQILLTHADLADRERYLN
ARSTLLTLLRLGVVPIINENDTVVTDEIKFGDNDTLGALVANLIEGDALIILTDQSGLFT
ADPRKDPAATLVAEANAGAPELEAMAGGAGSSLGRGGMLTKILAAKRAAHSGANTVIASG
REPDVLVRLAGGEAIGTQLIARTARMAARKQWMADHLQVRGHVVIDAGAVEKLTAGGKSL
LPIGVTDVQGAFARGEVIACVGPDGREVARGLTNYSSAETKLIHRKPSGEIESVLGYMLE
PELIHRDNLVLV

BLAST