GenomeNet

>bmj:BMULJ_00438 proB; gamma-glutamyl kinase (EC:2.7.2.11); K00931 glutamate 5-kinase [EC:2.7.2.11] (A)
MRSIIADSKRLVVKVGSSLVTNDGKGLDHAAIGRWAAQIAALRAQGKEVVLVSSGAIAEG
MQRLGWSKRPREIDELQAAAAVGQMGLAQVYESRFTEHGIRTAQILLTHADLADRERYLN
ARSTLLTLLRLGVVPIINENDTVVTDEIKFGDNDTLGALVANLIEGDALIILTDQSGLFT
ADPRKDPAATLVAEANAGAPELEAMAGGAGSSLGRGGMLTKILAAKRAAHSGANTVIASG
REPDVLVRLAGGEAIGTQLIARTARMAARKQWMADHLQVRGHVVIDAGAVEKLTAGGKSL
LPIGVTDVQGAFARGEVIACVGPDGREVARGLTNYSSAETKLIHRKPSGEIESVLGYMLE
PELIHRDNLVLV

BLAST