GenomeNet

>bmn:BMA10247_A0846 K00137 aminobutyraldehyde dehydrogenase [EC:1.2.1.19] | (GenBank) aldehyde dehydrogenase family protein (A)
MLINGLCIEGGGEPLSIVDPATGEPLAAPAAASAADLERAVAAAEAAFPAWRATTPATRA
SLLLALADEIDRQAGALARIESRNTGKPLHLVVQDELLAVADCFRFYAGAARTASGPSAG
EYVEGHTSMVRRDPIGVVAQIAPWNYPLMMAAWKLAPALAAGNTIVFKPSEWTPLSIVAL
EAALARIFPTGVVNIVLGDGASVGRALATHPRVRMISLTGSVEAGKSVLAAAAGNLKRTH
LELGGKAPVLVFDDADLDAAVAGIRYAGFYNAGQDCTAATRIYVQRGIYDTLAQRLADAA
STLRVGPPDRADAEMGPLVSAAHRARVERFVREAAALRHARVLTGGAPLPGPGCYYAPTV
IAGVRHDDAPMRREAFGPVVTLTPFDTESQALRWANDSEYGLASSVWTRDAARGMRLAAC
IDAGVTWVNAHFTYTADMPHGGTKQSGYGSDLSTLGLADYTQPRHVMWRH

BLAST