GenomeNet

>bmt:BSUIS_B0858 Hypothetical protein, conserved; K00111 glycerol-3-phosphate dehydrogenase [EC:1.1.5.3] (A)
MAEPETCDLFVIGGGINGAGVARDAAGRGLKVVLAEKDDLAQGTSSRSGKLVHGGLRYLE
YYEFRLVREALIEREVLLNAAPHIIWPMRFVLPHSPQDRPAWLVRLGLFLYDHLGGRKKL
PGTRTLDLKRDPEGTPILDQYTKGFEYSDCWVDDARLVALNAVGAAEKGATILTRTPVVS
ARRENGGWIVETRNSDTGETRTFRARCIVNCAGPWVTDVIHNVAASTSSRNVRLVKGSHI
IVPKFWSGANAYLVQNHDKRVIFINPYEGDKALIGTTDIAYEGRAEDVAADEKEIDYLIT
AVNRYFKEKLRREDVLHSFSGVRPLFDDGKGNPSAVTRDYVFDLDETGGAPLLNVFGGKI
TTFRELAERGMHRLKHIFPQMGGDWTHDAPLPGGEIANADYETFANTLRDTYPWMPRTLV
HHYGRLYGARTKDVVAGAQNLEGLGRHFGGDFHEAEVRYLVAREWAKTAEDILYRRTKHY
LHLTEAERAAFVEWFDNANLVA

BLAST