GenomeNet

>bmt:BSUIS_B0858 K21054 D-erythritol 1-phosphate dehydrogenase [EC:1.1.1.402] | (GenBank) Hypothetical protein, conserved (A)
MAEPETCDLFVIGGGINGAGVARDAAGRGLKVVLAEKDDLAQGTSSRSGKLVHGGLRYLE
YYEFRLVREALIEREVLLNAAPHIIWPMRFVLPHSPQDRPAWLVRLGLFLYDHLGGRKKL
PGTRTLDLKRDPEGTPILDQYTKGFEYSDCWVDDARLVALNAVGAAEKGATILTRTPVVS
ARRENGGWIVETRNSDTGETRTFRARCIVNCAGPWVTDVIHNVAASTSSRNVRLVKGSHI
IVPKFWSGANAYLVQNHDKRVIFINPYEGDKALIGTTDIAYEGRAEDVAADEKEIDYLIT
AVNRYFKEKLRREDVLHSFSGVRPLFDDGKGNPSAVTRDYVFDLDETGGAPLLNVFGGKI
TTFRELAERGMHRLKHIFPQMGGDWTHDAPLPGGEIANADYETFANTLRDTYPWMPRTLV
HHYGRLYGARTKDVVAGAQNLEGLGRHFGGDFHEAEVRYLVAREWAKTAEDILYRRTKHY
LHLTEAERAAFVEWFDNANLVA

BLAST