GenomeNet

>bmu:Bmul_6253 DNA polymerase LigD ligase subunit (A)
MQRRTTAQKTRAGVVVAKNARMSEFIAPALAVLMSEPPPAGDWAYEIKFDGYRMLVRVDD
GDVRLYTRNGHDWTSKLPHLTAVLKRLPVQRAWLDAEAVCFAPDGRPNFSRLQEAFNSRR
TTGICLVVFDLMWIDDTDLRRRPWHERRSALTGIIGEVLREEVRFSEAIEADASAMLASA
CELGLEGIIGKQIDAPYRSGRSDRWIKLKCVRRQEFVIGGFSRRKGATAGVRALLLGVYE
EGGRLRYVGHVAPSFTPRQAREFESRLSALGRKRSPFASAPDPEVDREFHWLKPDLVAEV
AFLEWTPAGRLRHPSFCGLRADKPARTVSRENPASPKGAGSRR

BLAST