GenomeNet

>bmu:Bmul_6253 no KO assigned | (GenBank) DNA polymerase LigD, ligase domain protein (A)
MQRRTTAQKTRAGVVVAKNARMSEFIAPALAVLMSEPPPAGDWAYEIKFDGYRMLVRVDD
GDVRLYTRNGHDWTSKLPHLTAVLKRLPVQRAWLDAEAVCFAPDGRPNFSRLQEAFNSRR
TTGICLVVFDLMWIDDTDLRRRPWHERRSALTGIIGEVLREEVRFSEAIEADASAMLASA
CELGLEGIIGKQIDAPYRSGRSDRWIKLKCVRRQEFVIGGFSRRKGATAGVRALLLGVYE
EGGRLRYVGHVAPSFTPRQAREFESRLSALGRKRSPFASAPDPEVDREFHWLKPDLVAEV
AFLEWTPAGRLRHPSFCGLRADKPARTVSRENPASPKGAGSRR

BLAST