GenomeNet

>bmw:BMNI_I1442 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) Protein gstA (A)
MLTIYSQPDSGNCYKPRLLLAKLGKPFRHVTVSALDGSTRTPEYLARNPNGKVPLLELED
GRFLAESNAILLYLAEGTRFLPVDPYERALVYQWLFFEQYSHEPYIAVRRALKIYPERAG
DATPERLAATLAGGEKALSVMDVQLRKTPFIAGDHYTVADIALYAYTHEAHLGGFDMQKY
RAVGDWLERVAADKGHVPIDWLP

BLAST