GenomeNet

>bmw:BMNI_II1024 K00627 pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12] | (GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2 (A)
MATEILYPKVSLETNSGTISRWHVQDGDAVEQGQILFEIDNDKTVVEVDAPHAGTVKILK
SSTTDEIEVGQSVASLFAKGETITAPPAPAAAQNASAPKTADILAVVNKGQNGRAIATPL
ARRLANDAGIDLDRIGGTGPGGRIQKKDVIAALQSCPSIPETIAASRQARPEGDCLLNAV
WLRKGEGTPLVLLHGFASDHNNWRGLFAGTQWQQPLLAIDLPSHGASPLVAVTSLDAIAA
MIEATLKALDIQRAILVGHSFGAAVSARLANRGNIDIRALGLFSPAGLGPEINVGFVQNF
VRARARESVTPWLHELVHDKASISDTFIKAVVQQRQDNDLSDAMMAFSEHFFADGTQTVS
ILDDLASLEIPVRVIYGRQDRILPFRYTRNLPDNVALYAFDACGHMPHLEKRGLSLRILA
EVSASAAG

BLAST