GenomeNet

>bmy:Bm1_00260 Protein set-1; K11428 histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43] (A)
MVITVRLTYGTDEKRQTILLHRGLPVSALSNRMLDKIVHRKRGGARSTKKKTTRKGKSVG
KETEKSDDASTHKITEYFPLRRSSRKTEKQLEQEERDAMANAILTGSNEEFLEIFECEEK
GRGIRTLRNFQKNEFVVEYKGEIIDLRLARIREREYAKDDSIGSFMYFFKYQNKQYCVDA
TDETPYKGRLINHSVIRPNLKTKVIELNGSKHLILIAKRDIDIGEELLYDYGDRTPCTVA
ENPWLLNS

BLAST